DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and Clvs2

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_780657.1 Gene:Clvs2 / 215890 MGIID:2443223 Length:327 Species:Mus musculus


Alignment Length:269 Identity:66/269 - (24%)
Similarity:131/269 - (48%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 APET--------SASPATGWSD--KLTDLVAWFEANPNLP-EKIEPIVMLRFLKCTAF-DVERTK 63
            :|||        :.:|.|...|  ::.|:|.   ..|::. .:.:...:||||:...| ..|..:
Mouse     9 SPETLEKARLELNENPDTLHQDIQEVRDMVI---TRPDIGFLRTDDAFILRFLRARKFHHFEAFR 70

  Fly    64 ALAE-LNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNS 127
            .||: ..|..:|      :|.....:.|..|::.:    |....|.|       :|:||...|  
Mouse    71 LLAQYFEYRQQN------LDMFKSFKATDPGIKQA----LKDGFPGG-------LANLDHYGR-- 116

  Fly   128 VEETKIFVMMS----DARFTKPDVERETGSGADYVLDEADI-AEGDVQIVDIGGYTLRHLAYVSI 187
                ||.|:.:    .:|:|..|:.|......:.::::.:: ..|.|.|:|...:|.:..:.::.
Mouse   117 ----KILVLFAANWDQSRYTLVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTP 177

  Fly   188 FVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPR 252
            .:||:.::.||:::|:|...:|.:|.|.|:..|.:::.|||:|:.|..|..|...::||::.:..
Mouse   178 NMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHP 242

  Fly   253 DMLPNEYGG 261
            ::||:|:||
Mouse   243 EILPSEFGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 44/166 (27%)
Clvs2NP_780657.1 CRAL_TRIO_N 29..75 CDD:215024 12/48 (25%)
SEC14 106..251 CDD:238099 40/157 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835972
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.