DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and Rlbp1

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:220 Identity:51/220 - (23%)
Similarity:102/220 - (46%) Gaps:30/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQ---- 108
            :|||::...|||.|...|.:.....|.:.|.||      |.::.|.||.:.....|||...    
Mouse    96 LLRFIRARKFDVGRAYELLKGYVNFRLQYPELF------DSLSMEALRCTIEAGYPGVLSSRDKY 154

  Fly   109 GNKLIFFRMAD--LDPRTRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQI 171
            |..::.|.:.:  .:..|.:.:.:...|::       :..:|.|          |..| .|...:
Mouse   155 GRVVMLFNIENWHCEEVTFDEILQAYCFIL-------EKLLENE----------ETQI-NGFCIV 201

  Fly   172 VDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMI 236
            .:..|:|::..|.:....|:..:..||:::|:|.:|:|.|:.|.|.....:::.|||:.::...:
Mouse   202 ENFKGFTMQQAAGLRPSDLKKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRV 266

  Fly   237 RYHTEGMDSLYKEVPRDMLPNEYGG 261
            ..|.:.:|..::|:..::||.::||
Mouse   267 FVHGDDLDGFFQEIDENILPADFGG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 35/167 (21%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 8/20 (40%)
CRAL_TRIO 143..292 CDD:395525 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835984
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.