DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and ctg-2

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:358 Identity:81/358 - (22%)
Similarity:144/358 - (40%) Gaps:98/358 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TGDKDSAPETSASPATGWSDKLTDLVAWFEANPNLPEKIEPI-------VMLRFLKCTAFDVERT 62
            :|::.|   ||....|....||.|     |....:.:::|.:       .::|:|  ..:|.:..
 Worm     9 SGERMS---TSTGEITESDRKLLD-----ELRKRIHKELELVKEYDDDFSLMRWL--IGWDRKID 63

  Fly    63 KALAELNYCMRNKSPH-LFMDRNMEDEMTAEGL--RVSD----LLILPGV---TPQGNKLIFFRM 117
            ..:.::.:.:|  :.| |.:|:  ||..|.|.:  :..|    |..|||.   ....|.::..:|
 Worm    64 VVVPKIKFSLR--AIHALGLDQ--EDLSTLEKVAQKCDDCSVPLRYLPGSLIGLDHENNVVSLQM 124

  Fly   118 ------ADLDPRTRNS------VEETKIFVMMSDARFTKPDVERETGSGADYVLDEADIAEGDVQ 170
                  |.|.|.||||      :.|::  .:|...|    .:|:|.|...           |...
 Worm   125 IGHLDAAGLMPATRNSDLYRMRIAESE--GVMQIIR----KMEKEQGKPL-----------GTSV 172

  Fly   171 IVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNM 235
            |.|:.|.::..:...::.|:...:..|||.:|..::.:.::|.||::..|.||:||.|.::.:..
 Worm   173 IFDLDGLSMVQIDLAALKVVTTMLSQLQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQK 237

  Fly   236 IR-YHTEGMDSLYKEVPRDMLPNEYGG--KAGT-----------VAELKAKGIQSIRDNAAYLSD 286
            :: ...:....|.:.:..::|...:||  ||.|           .||||       .|.|..|..
 Worm   238 VKILGNDWKQHLKENIGEEVLFERWGGTRKAETEYGNVRMGGKIPAELK-------YDPANDLPA 295

  Fly   287 ERYWK--VAAQS---------------KSRWSW 302
            |:..|  |:|:|               |..|.|
 Worm   296 EKLTKLNVSARSTTFVPITLEGNVPGRKLYWWW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 40/178 (22%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 42/185 (23%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.