DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and H41C03.1

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_495168.1 Gene:H41C03.1 / 173994 WormBaseID:WBGene00019268 Length:396 Species:Caenorhabditis elegans


Alignment Length:302 Identity:71/302 - (23%)
Similarity:123/302 - (40%) Gaps:87/302 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DKLTDLVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDE 88
            |.||:   :::.:.||         ||:.:...||  :.:|||||...:|.:..:     ::::.
 Worm    18 DLLTE---YYDTDFNL---------LRWAQGYGFD--KDEALAELRRHLRFRQYY-----DLDNI 63

  Fly    89 MTAEGLRVSDLLILP--------GVTPQGNKLIFFRMA---DL----------DPRTRNSVEETK 132
            :|    .|.|..||.        |.|.:.|:|:....|   ||          |...:....:.|
 Worm    64 LT----NVPDHPILKKYFPLGLVGETGKDNQLLVIECAGRIDLMGILKSVHLSDFLIQRFKFQEK 124

  Fly   133 IFVMMSDARFTKPDVERETGSGAD--YVLDEADIAEG---DVQIVDI--GGYTLRHLAYVSIFVL 190
            :...|:       ::||:.|:...  |:||    .||   |..::.|  |.|   .:.:.|::. 
 Worm   125 MLAAMN-------EMERKYGTQCSVIYILD----LEGLKFDPALISIVTGPY---RILWASVYT- 174

  Fly   191 RVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMD---SLYKEVPR 252
                     |||..:..:.:||.|:::..|...:.|.|.|..||.:|..:...|   |:.|....
 Worm   175 ---------AYPEWINTLFLINAPSFMTLLWKAIGPLLPERTRNKVRICSGNSDWKTSVQKHAHI 230

  Fly   253 DMLPNEYGGKAGTVAELKAKGIQSIRD--NAAY--LSDERYW 290
            |.:|..:|   ||:.:....|:  .||  |..:  :..|.||
 Worm   231 DNIPKHWG---GTLVDKNGDGM--CRDILNIPFDSIPQELYW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 44/191 (23%)
H41C03.1NP_495168.1 SEC14 69..242 CDD:214706 47/199 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.