DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3091 and CLVS1

DIOPT Version :9

Sequence 1:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:220 Identity:51/220 - (23%)
Similarity:112/220 - (50%) Gaps:28/220 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 MLRFLKCTAF-DVERTKALAELNYCMRNKSPHLFMDRNMEDEMTAEGLRVSDLLILPGVTPQ--- 108
            :||||:...| ..:..:.||:. :..|..:..:|.:...:|    .|::.:.:...|||...   
Human    76 ILRFLRARKFHQADAFRLLAQY-FQYRQLNLDMFKNFKADD----PGIKRALIDGFPGVLENRDH 135

  Fly   109 -GNKLIFFRMADLDPRTRNSVEETKIFVMMSDARFTKPDVERETGSGADYVLDEADI-AEGDVQI 171
             |.|::....|:.| ::|||              ||  |:.|......:.::::.:: ..|.:.|
Human   136 YGRKILLLFAANWD-QSRNS--------------FT--DILRAILLSLEVLIEDPELQINGFILI 183

  Fly   172 VDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMI 236
            :|...::.:..:.::..:|::.::.||:::|:|...:|.:|.|.|:..|.:::.|||:::.|..|
Human   184 IDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRI 248

  Fly   237 RYHTEGMDSLYKEVPRDMLPNEYGG 261
            ..|...::||::.:..:.||:|:||
Human   249 FLHGNNLNSLHQLIHPEFLPSEFGG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 40/166 (24%)
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 7/20 (35%)
CRAL_TRIO 125..274 CDD:306996 40/166 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145882
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 1 1.000 - - FOG0000233
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.