DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and SEC14L5

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:313 Identity:61/313 - (19%)
Similarity:119/313 - (38%) Gaps:83/313 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSDTSEQAV----RKQERDLKELLEWFRQ--NDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVN 81
            |:|..|:.:    ..||..|.:|..|.::  ..|:||:...|   ||.:.....:::.|:::..:
Human   227 DADYIERCLGHLTPMQESCLIQLRHWLQETHKGKIPKDEHIL---RFLRAHDFHLDKAREMLRQS 288

  Fly    82 YALRNRHPHLFIKRDPLDADSKRTFDYADIL-----PLPGLTPDKCKVSLYCFREFEASKMHHTE 141
            .:.|.:|                   ..|:|     | |.|           ..||.|...|:.:
Human   289 LSWRKQH-------------------QVDLLLQTWQP-PAL-----------LEEFYAGGWHYQD 322

  Fly   142 -DTRAFFMVSDCRFVTP-------DDLAKPDVLS---------EGEVQ-----------IFDMKG 178
             |.|..:::...:..|.       ::.....|||         ||..:           :.|::|
Human   323 IDGRPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNEEGQKRCEGSTRQLGRPISSWTCLLDLEG 387

  Fly   179 TTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHT- 242
            ..|||:.|..:..|...|:.::..:|..|..:.::..|.....:.:::.|||::...:....:: 
Human   388 LNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFINENTRRKFLIYSG 452

  Fly   243 ---QSINTLYEFVPREMLPEEYGGGA------GSLEALRTHTQKALVEHRDYL 286
               |....|.:::.||::|:..||.:      |.|.....:..:...||.|.|
Human   453 SNYQGPGGLVDYLDREVIPDFLGGESVCNVPEGGLVPKSLYMTEEEQEHTDQL 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 33/180 (18%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
CRAL_TRIO_N 243..288 CDD:215024 11/47 (23%)
SEC14 306..479 CDD:214706 36/184 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.