DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and PDR17

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_014135.1 Gene:PDR17 / 855457 SGDID:S000005208 Length:350 Species:Saccharomyces cerevisiae


Alignment Length:160 Identity:38/160 - (23%)
Similarity:57/160 - (35%) Gaps:32/160 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDT-----RAFFMVSDCRF 154
            :|||.||.....:......:.|.  |..|..||    :..:...:||.:     ...:|:.....
Yeast   132 KDPLTADKVAVENETGKQVILGF--DNAKRPLY----YMKNGRQNTESSFRQVQELVYMMETATT 190

  Fly   155 VTPDDLAKPDVL----SEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINC 215
            |.|..:.|..||    |..|..|...|..        .||..|..:..:|..:|.||....:||.
Yeast   191 VAPQGVEKITVLVDFKSYKEPGIITDKAP--------PISIARMCLNVMQDHYPERLAKCVLINI 247

  Fly   216 PTYLDRIVSVVKPF---------ISDEVFK 236
            |.:....:.::.||         |.||.|:
Yeast   248 PWFAWAFLKMMYPFLDPATKAKAIFDEPFE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 33/141 (23%)
PDR17NP_014135.1 CRAL_TRIO_N 49..115 CDD:397711
CRAL_TRIO 146..291 CDD:395525 33/146 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.