DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and YKL091C

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:271 Identity:66/271 - (24%)
Similarity:108/271 - (39%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GTSEQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQC----------M 67
            ||...|.:||     |:|: .|.|.:  |||   :|.|  :.:|...|.||.:.          |
Yeast    20 GTPGNLTKEQ-----EEAL-LQFRSI--LLE---KNYK--ERLDDSTLLRFLRARKFDINASVEM 71

  Fly    68 FGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFRE- 131
            |.:.|..|:....|..:.:       ..:..:|:.|.....|.:.|......||....|| |.| 
Yeast    72 FVETERWREEYGANTIIED-------YENNKEAEDKERIKLAKMYPQYYHHVDKDGRPLY-FEEL 128

  Fly   132 --FEASKMHH--TEDTRAFFMVSDCR-FVT---PDDLAKPDVLSEGEVQIFDMKGTTMRHISRLT 188
              ....||:.  ||......:|.:.. |.|   |....:...|.|....:.|:||.::.:...: 
Yeast   129 GGINLKKMYKITTEKQMLRNLVKEYELFATYRVPACSRRAGYLIETSCTVLDLKGISLSNAYHV- 192

  Fly   189 ISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISD-EVFKLIRFHTQSINTLYEFV 252
            :|.::......|..:|.|:...::|:.|.....:..:||||:.. .|.|:....:.....|.:.:
Yeast   193 LSYIKDVADISQNYYPERMGKFYIIHSPFGFSTMFKMVKPFLDPVTVSKIFILGSSYKKELLKQI 257

  Fly   253 PREMLPEEYGG 263
            |.|.||.:|||
Yeast   258 PIENLPVKYGG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 37/158 (23%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 15/52 (29%)
SEC14 101..271 CDD:214706 41/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.