DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and SFH5

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:51/263 - (19%)
Similarity:94/263 - (35%) Gaps:59/263 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TSEQLQREQDSDTSEQAVRKQ-----------ERDLKELLEWFRQNDKLPKEIDPLLLRRFYQCM 67
            |.|::.:..|...:::...|.           .::|.::|.|.|       |.:||      .|.
Yeast    44 TQEEVDKYYDEKIADRLTYKLCKAYQFEYSTIVQNLIDILNWRR-------EFNPL------SCA 95

  Fly    68 FGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKR-TFD-YADILPLPGLTPDKCKVSLYCFR 130
            :.:|..|.        |:|.....|....  ||:.|. |:: |..::....|..:..|...|...
Yeast    96 YKEVHNTE--------LQNVGILTFDANG--DANKKAVTWNLYGQLVKKKELFQNVDKFVRYRIG 150

  Fly   131 EFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAY 195
            ..|...      :...|..||..::|               |:.|.||.::..:.....:..:..
Yeast   151 LMEKGL------SLLDFTSSDNNYMT---------------QVHDYKGVSVWRMDSDIKNCSKTV 194

  Fly   196 IKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPEE 260
            |...|..:|..|.|.:.:|.||....:..::|.|:.:...|.....|.. :.|.::: ::...|.
Yeast   195 IGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVLTDG-SKLGQYL-KDCPYEG 257

  Fly   261 YGG 263
            |||
Yeast   258 YGG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 27/148 (18%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 38/193 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.