DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and AT1G75170

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001031283.1 Gene:AT1G75170 / 843854 AraportID:AT1G75170 Length:296 Species:Arabidopsis thaliana


Alignment Length:270 Identity:59/270 - (21%)
Similarity:109/270 - (40%) Gaps:53/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SEQLQREQDSDTSEQAVRKQE-RDLKELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVEETRKLI 78
            |.|.::||    .|.|:|:.: ::||.|:......:.|  ......|:|:.:....:|.:.:|::
plant     7 SSQTEQEQ----KEAALREAKMKELKTLIGQLSGRNSL--YCSDACLKRYLEARNWNVGKAKKML 65

  Fly    79 EVNYALRNRHPHLFIKRDPLDADSK--------------RTFDYADILPLPGLTPDKCKVSLYCF 129
            |.....|:......|:.:.:..:.:              ||.    ::..|||...|   ||   
plant    66 EETLKWRSSFKPEEIRWNEVSGEGETGKVYKAGFHDRHGRTV----LILRPGLQNTK---SL--- 120

  Fly   130 REFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRA 194
                .::|.|     ..:::.:.....|:|       .|....:.|..|.:|.  :.:.|.:.|.
plant   121 ----ENQMKH-----LVYLIENAILNLPED-------QEQMSWLIDFTGWSMS--TSVPIKSARE 167

  Fly   195 YIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRF----HTQSINTLYEFVPRE 255
            .|..||..:|.||....:.|.|...:....:||.||..:.|..::|    :::|:..:..|...|
plant   168 TINILQNHYPERLAVAFLYNPPRLFEAFWKIVKYFIDAKTFVKVKFVYPKNSESVELMSTFFDEE 232

  Fly   256 MLPEEYGGGA 265
            .||.|:||.|
plant   233 NLPTEFGGKA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 36/152 (24%)
AT1G75170NP_001031283.1 CRAL_TRIO_N 21..68 CDD:215024 9/48 (19%)
SEC14 98..241 CDD:238099 39/170 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.