DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and AT1G72160

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_177361.1 Gene:AT1G72160 / 843547 AraportID:AT1G72160 Length:490 Species:Arabidopsis thaliana


Alignment Length:327 Identity:66/327 - (20%)
Similarity:115/327 - (35%) Gaps:88/327 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ETGASGTSEQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVE 72
            ||.|......:...:.:.|.:|.| |.|...||:.|  .:...:|:.:...            .|
plant    62 ETAAEHHPPTVTETETASTEKQEV-KDEASQKEVAE--EKKSMIPQNLGSF------------KE 111

  Fly    73 ETRKLIEVNYALRNRHPHL-FIKRDPLDADS-KRTFDYADILPLPGLTPDKCKVSLYCF---REF 132
            |:.||.:::.:.:.....| .:.|:.||... ..|.:...|..:|.|..|:..|.|..|   |||
plant   112 ESSKLSDLSNSEKKSLDELKHLVREALDNHQFTNTPEEVKIWGIPLLEDDRSDVVLLKFLRAREF 176

  Fly   133 EA-------------------------------------------------------------SK 136
            :.                                                             :|
plant   177 KVKDSFAMLKNTIKWRKEFKIDELVEEDLVDDLDKVVFMHGHDREGHPVCYNVYGEFQNKELYNK 241

  Fly   137 MHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIF---DMKGTTMRHISRLTISTLRAYIKF 198
            ....|:.|..|:.:..:|: ...:.|.|..|.|...||   |||.:.......|..:|.:| ::.
plant   242 TFSDEEKRKHFLRTRIQFL-ERSIRKLDFSSGGVSTIFQVNDMKNSPGLGKKELRSATKQA-VEL 304

  Fly   199 LQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRF--HTQSINTLYEFVPREMLPEEY 261
            ||..:|..:.....||.|.:.....:|:.||::......:.|  .::|..||::::..|.:|.:|
plant   305 LQDNYPEFVFKQAFINVPWWYLVFYTVIGPFMTPRSKSKLVFAGPSRSAETLFKYISPEQVPVQY 369

  Fly   262 GG 263
            ||
plant   370 GG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 42/217 (19%)
AT1G72160NP_177361.1 PRK11907 2..>97 CDD:237019 11/37 (30%)
CRAL_TRIO_N 127..187 CDD:397711 15/59 (25%)
SEC14 203..372 CDD:238099 35/171 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.