DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and AT1G30690

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001031119.1 Gene:AT1G30690 / 839949 AraportID:AT1G30690 Length:540 Species:Arabidopsis thaliana


Alignment Length:324 Identity:69/324 - (21%)
Similarity:133/324 - (41%) Gaps:70/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TSEQLQREQ--------DSDTSEQAVRKQE---RDLK-ELLEWFRQNDKLPKEID----PLL--- 59
            |.|.:.:|:        :.:|.|:..:.::   .::| |.:|...:::.:.|:|:    |||   
plant   150 TEEIIPKEEVTTVVEKVEEETKEEEKKTEDVVTEEVKAETIEVEDEDESVDKDIELWGVPLLPSK 214

  Fly    60 --------LRRFYQCMFGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTF--DYADILPL 114
                    |.:|.:.....|.|..::::.....|        |::.:|:.....|  |.|....:
plant   215 GAESTDVILLKFLRARDFKVNEAFEMLKKTLKWR--------KQNKIDSILGEEFGEDLATAAYM 271

  Fly   115 PGLTPDKCKVSLYCFREFEASKMHHT---EDTRAFFMVSDCRFVTPDDLAKPDVLSEGEV----Q 172
            .|:..:...|   |: ...:.:::.|   |..|..|:  ..||...:...:...|..|.|    |
plant   272 NGVDRESHPV---CY-NVHSEELYQTIGSEKNREKFL--RWRFQLMEKGIQKLNLKPGGVTSLLQ 330

  Fly   173 IFDMKGTTMRHISRLTIST-LRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEV-- 234
            |.|:|...  .:||..|.. ::..|:.||..:|..:.....||.|.:...:.:|:.||::...  
plant   331 IHDLKNAP--GVSRTEIWVGIKKVIETLQDNYPEFVSRNIFINVPFWFYAMRAVLSPFLTQRTKS 393

  Fly   235 -FKLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLEALRTHTQKALVEHRDYLMDPDHWVVVKP 297
             |.:.| ..:...||.:::|.:.||.:|||       .:|      |:..::..:....|||||
plant   394 KFVVAR-PAKVRETLLKYIPADELPVQYGG-------FKT------VDDTEFSNETVSEVVVKP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 37/159 (23%)
AT1G30690NP_001031119.1 CRAL_TRIO_N <219..244 CDD:215024 4/24 (17%)
SEC14 273..422 CDD:214706 37/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.