DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and AT1G05370

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_172029.2 Gene:AT1G05370 / 837038 AraportID:AT1G05370 Length:417 Species:Arabidopsis thaliana


Alignment Length:221 Identity:42/221 - (19%)
Similarity:88/221 - (39%) Gaps:44/221 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RKQERDLKELLEWFRQNDK------LPKEIDPLLLR-----------RFYQCMFGDVEETRKLIE 79
            :|:::|...::|   .:||      |.::..||.|:           ||.:....:|::..|.:.
plant     3 KKEQKDHHSVVE---SDDKVEAVLHLLRKHSPLTLKQEKFCNRACVGRFLRIKGDNVKKAAKQLR 64

  Fly    80 VNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTED-- 142
            ...:.|:.     :..:.|.|| :.|.:.|:.|.......|:|:..| .||..:..:..||:.  
plant    65 SCLSWRSS-----LGIESLIAD-EFTAELAEGLAYVAGLDDECRPVL-VFRIKQDYQKLHTQKQL 122

  Fly   143 TRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFD---MKGTTMRHISRLTISTLRAYIKFLQLAFP 204
            ||......:....|.....:..|:      :||   .|..:.  ...:.::||:...::    :|
plant   123 TRLVVFTLEVAISTMSRNVEQFVI------LFDASFFKSASA--FMNILVTTLKIVAEY----YP 175

  Fly   205 VRLRAIHMINCPTYLDRIVSVVKPFI 230
            .||....:|:.|:....:...::.|:
plant   176 CRLFKTFVIDPPSLFSYLWKGIRTFV 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 22/122 (18%)
AT1G05370NP_172029.2 SEC14 89..219 CDD:238099 23/126 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.