DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and AT3G22410

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_188880.1 Gene:AT3G22410 / 821809 AraportID:AT3G22410 Length:400 Species:Arabidopsis thaliana


Alignment Length:203 Identity:38/203 - (18%)
Similarity:68/203 - (33%) Gaps:59/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VRKQERDLKELLEWFRQN---DKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVNYALRNRHPHLF 92
            |:|..:.|...|.| |||   ::|..|.....|......:.|...|:|.:|    ..|.:|    
plant    45 VKKAAKQLSSCLSW-RQNFDIERLGAEEFSTELSDGVAYISGHDRESRPVI----IFRFKH---- 100

  Fly    93 IKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDCRFVTP 157
                          ||..:......|    ::..:......:|...:||  ::|.::.|..|...
plant   101 --------------DYQKLHTQKQFT----RLVAFTIETAISSMSRNTE--QSFVLLFDASFFRS 145

  Fly   158 DDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRI 222
            ...                       .:.|.::||    |.:...:|.||....:|:.|::...:
plant   146 SSA-----------------------FANLLLATL----KIIADNYPCRLYKAFIIDPPSFFSYL 183

  Fly   223 VSVVKPFI 230
            ...|:||:
plant   184 WKGVRPFV 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 19/117 (16%)
AT3G22410NP_188880.1 SEC14 78..209 CDD:238099 27/169 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.