DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and TTPA

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_000361.1 Gene:TTPA / 7274 HGNCID:12404 Length:278 Species:Homo sapiens


Alignment Length:264 Identity:60/264 - (22%)
Similarity:110/264 - (41%) Gaps:30/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 AVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVNYALRNRHPHLFIK 94
            |:|::.|:....|        .|..:....|.||.:....|::...:|::..|..|...|.:...
Human    30 ALRRRAREAGVPL--------APLPLTDSFLLRFLRARDFDLDLAWRLLKNYYKWRAECPEISAD 86

  Fly    95 RDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDD 159
            ..|..........|..:  |....|...||.:|....::.......:..|...:.|:.       
Human    87 LHPRSIIGLLKAGYHGV--LRSRDPTGSKVLIYRIAHWDPKVFTAYDVFRVSLITSEL------- 142

  Fly   160 LAKPDVLSEGEVQ------IFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTY 218
                 ::.|.|.|      |||::|....|..::|.|..:.....|..:||:::|.||:||.|..
Human   143 -----IVQEVETQRNGIKAIFDLEGWQFSHAFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVI 202

  Fly   219 LDRIVSVVKPFISDEVFKLIRFHTQSI-NTLYEFVPREMLPEEYGGGAGSLEALRTHTQKALVEH 282
            ...:.|::|||:::::.:.|..|..:. .:|.:..| ::||.||||...|:|.:.......:::.
Human   203 FHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFP-DILPLEYGGEEFSMEDICQEWTNFIMKS 266

  Fly   283 RDYL 286
            .|||
Human   267 EDYL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 38/155 (25%)
TTPANP_000361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
CRAL_TRIO_N <40..73 CDD:215024 7/40 (18%)
CRAL_TRIO 99..248 CDD:395525 40/163 (25%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.