DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and Sec14l2

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_653103.1 Gene:Sec14l2 / 67815 MGIID:1915065 Length:403 Species:Mus musculus


Alignment Length:257 Identity:52/257 - (20%)
Similarity:98/257 - (38%) Gaps:50/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KQERDLKELLEWFRQN--DKLP--KEIDPLLLRRFYQCMFGDVEETRKLIEVNYALRNR------ 87
            |||    |.|..||:|  |.||  ...|...|.|:.:....|::::..::..:...|.:      
Mouse    11 KQE----EALAKFRENVQDVLPTLPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDKI 71

  Fly    88 ---------HPHLFIKRDPLDADSKRT-FDYADILPLPGLTPDKCKVSLYCFREFEASK--MHHT 140
                     ..:|...|...|.|.... :|....|...||.             |.|||  :..|
Mouse    72 ISWQPPEVIQQYLSGGRCGYDLDGCPVWYDIIGPLDAKGLL-------------FSASKQDLLRT 123

  Fly   141 EDTRAFFMVSDCRFVTPDDLAKPDVLS---EGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLA 202
            :       :.||..:..:.:.:...|.   |....|:|.:|..::|:.:..:.....::...:..
Mouse   124 K-------MRDCELLLQECIQQTTKLGKKIETITMIYDCEGLGLKHLWKPAVEAYGEFLTMFEEN 181

  Fly   203 FPVRLRAIHMINCPTYLDRIVSVVKPFISDEV-FKLIRFHTQSINTLYEFVPREMLPEEYGG 263
            :|..|:.:.::..|.......:::|||:|::. .|::.........|.:.:..:.||.||||
Mouse   182 YPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRRKIMVLGANWKEVLLKHISPDQLPVEYGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 28/154 (18%)
Sec14l2NP_653103.1 CRAL_TRIO_N 13..59 CDD:215024 13/49 (27%)
SEC14 76..244 CDD:214706 36/188 (19%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.