DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and Sec14l5

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001121197.1 Gene:Sec14l5 / 665119 MGIID:3616084 Length:696 Species:Mus musculus


Alignment Length:285 Identity:62/285 - (21%)
Similarity:109/285 - (38%) Gaps:79/285 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSDTSEQAV----RKQERDLKELLEWFRQ--NDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVN 81
            |:|..|:.:    ..||..|.:|..|.::  ..|:||  |..:||                    
Mouse   227 DADYIERCLGHLSPMQESCLVQLRHWLQETHKGKIPK--DEHILR-------------------- 269

  Fly    82 YALRNRHPHLFIKRDPL-DADSKRTFDYADIL-----PLPGLTPDKCKVSLYCFREFEASKMHHT 140
             .||.|..||...||.| .:.|.|.....|:|     |.|.|            :||.|...|:.
Mouse   270 -FLRARDFHLDKARDMLCQSLSWRKQHQVDLLLQTWRPPPPL------------QEFYAGGWHYQ 321

  Fly   141 E-DTRAFFMVSDCRFVTP-------DDLAKPDVLS---------EGEVQIF-----------DMK 177
            : |.|..:::...:..|.       ::.....|||         ||..:.|           |::
Mouse   322 DIDGRPLYILRLGQMDTKGLMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLE 386

  Fly   178 GTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHT 242
            |..|||:.|..:..|...|:.::..:|..|..:.::..|.....:.::|.|||::...:....::
Mouse   387 GLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYS 451

  Fly   243 ----QSINTLYEFVPREMLPEEYGG 263
                |....|.:::.::::|:..||
Mouse   452 GSNYQGPGGLVDYLDKDVIPDFLGG 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 33/180 (18%)
Sec14l5NP_001121197.1 PRELI 17..173 CDD:368069
CRAL_TRIO_N 243..288 CDD:215024 18/67 (27%)
SEC14 306..479 CDD:214706 36/183 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.