Sequence 1: | NP_001245486.2 | Gene: | CG3191 / 31209 | FlyBaseID: | FBgn0023525 | Length: | 309 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034662.3 | Gene: | SEC14L1 / 6397 | HGNCID: | 10698 | Length: | 719 | Species: | Homo sapiens |
Alignment Length: | 272 | Identity: | 52/272 - (19%) |
---|---|---|---|
Similarity: | 98/272 - (36%) | Gaps: | 79/272 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 QERDLKELLEWFRQ--NDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVNYALRNRHPHLFIKRD 96
Fly 97 PLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLA 161
Fly 162 KPD----------------VLS---------EGEVQIF-----------DMKGTTMRHISRLTIS 190
Fly 191 TLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHT----QSINTLYEF 251
Fly 252 VPREMLPEEYGG 263 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3191 | NP_001245486.2 | SEC14 | 114..263 | CDD:238099 | 35/188 (19%) |
SEC14L1 | NP_001034662.3 | PRELI | 17..173 | CDD:368069 | |
CRAL_TRIO_N | 256..301 | CDD:215024 | 11/47 (23%) | ||
CRAL_TRIO | 326..490 | CDD:366224 | 33/178 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |