DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and SEC14L1

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001034662.3 Gene:SEC14L1 / 6397 HGNCID:10698 Length:719 Species:Homo sapiens


Alignment Length:272 Identity:52/272 - (19%)
Similarity:98/272 - (36%) Gaps:79/272 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QERDLKELLEWFRQ--NDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVNYALRNRHPHLFIKRD 96
            ||..|..|.:|.::  ..|:||:...|   ||.:....::::.|:::..:...|.:|        
Human   255 QESCLIRLRQWLQETHKGKIPKDEHIL---RFLRARDFNIDKAREIMCQSLTWRKQH-------- 308

  Fly    97 PLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLA 161
                    ..||.    |...||.:.....|.     ....||.:|.|..:::.         |.
Human   309 --------QVDYI----LETWTPPQVLQDYYA-----GGWHHHDKDGRPLYVLR---------LG 347

  Fly   162 KPD----------------VLS---------EGEVQIF-----------DMKGTTMRHISRLTIS 190
            :.|                |||         |...::|           |::|..|||:.|..:.
Human   348 QMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVK 412

  Fly   191 TLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHT----QSINTLYEF 251
            .|...|:.::..:|..|..:.::..|.....:.::|.|||.|...:....:.    |....|.::
Human   413 ALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDY 477

  Fly   252 VPREMLPEEYGG 263
            :.:|::|:...|
Human   478 IDKEIIPDFLSG 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 35/188 (19%)
SEC14L1NP_001034662.3 PRELI 17..173 CDD:368069
CRAL_TRIO_N 256..301 CDD:215024 11/47 (23%)
CRAL_TRIO 326..490 CDD:366224 33/178 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.