DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and RLBP1

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:283 Identity:73/283 - (25%)
Similarity:128/283 - (45%) Gaps:43/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LQREQD-----SDTSEQAVRKQERDLKELLE-WFRQNDKLP-------KEIDPLLLRRFYQCMFG 69
            ||:.:|     .:|.|:||    |:|:|::: .....::|.       :|.|.....||.:....
Human    54 LQKAKDELNEREETREEAV----RELQEMVQAQAASGEELAVAVAERVQEKDSGFFLRFIRARKF 114

  Fly    70 DVEETRKLIE--VNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCK----VSLYC 128
            :|....:|:.  ||:.|  ::|.||   |.|..::.|....|.   .||:...:.|    |.|:.
Human   115 NVGRAYELLRGYVNFRL--QYPELF---DSLSPEAVRCTIEAG---YPGVLSSRDKYGRVVMLFN 171

  Fly   129 FREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLR 193
            ...:::.::...|..:|:     | |:....|...:....|...|.:.||.||:..:.|..|.||
Human   172 IENWQSQEITFDEILQAY-----C-FILEKLLENEETQINGFCIIENFKGFTMQQAASLRTSDLR 230

  Fly   194 AYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLP 258
            ..:..||.:||.|.:|||.|:.|.|.....:|||||:..::.:.:..|...::..|:.:...:||
Human   231 KMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILP 295

  Fly   259 EEYGGGAGSLEALRTHTQKALVE 281
            .::||      .|..:..||:.|
Human   296 SDFGG------TLPKYDGKAVAE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 40/152 (26%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.