DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and sec14l7

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:XP_009303977.1 Gene:sec14l7 / 566865 ZFINID:ZDB-GENE-141216-145 Length:405 Species:Danio rerio


Alignment Length:268 Identity:57/268 - (21%)
Similarity:89/268 - (33%) Gaps:74/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VRKQERDLKELLEWFRQNDKLPKEID----PLLLRRFY---QCMFGDVEETRKLIEVNYALRNRH 88
            |.|.|..|::.|| ||::.||...||    |.:|.|:.   .|.:.               |...
Zfish    62 VPKAEAMLRKHLE-FRRHMKLETIIDDWSPPEVLERYVAGGMCGYD---------------REGS 110

  Fly    89 PHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDCR 153
            |..|....|||.              .||.....|..  |.|    :|:...|..|     .:|.
Zfish   111 PIWFDIIGPLDP--------------KGLLLSASKQD--CLR----TKIRDAELLR-----RECE 150

  Fly   154 FVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTY 218
                ....|.....|....|:|.:|..|:|:.:..:......:...:..:|..|:.:.:|..|..
Zfish   151 ----KQSKKLGKHIESITIIYDCEGLGMKHLWKPAVEMYGEILTMYEENYPESLKKVLLIKAPKL 211

  Fly   219 LDRIVSVVKPFISDEV-FKLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLEALRTHTQKALVEH 282
            .....::||.|:.:|. .|:....:...:.|..:|..:.:|..|||.                  
Zfish   212 FPIAYNLVKHFLREETRQKIAVLGSNWKDVLKNYVDADQIPAAYGGS------------------ 258

  Fly   283 RDYLMDPD 290
               |.|||
Zfish   259 ---LTDPD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 29/149 (19%)
sec14l7XP_009303977.1 CRAL_TRIO_N 26..72 CDD:215024 4/9 (44%)
CRAL_TRIO 97..258 CDD:279044 37/204 (18%)
GOLD_2 317..395 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.