DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:273 Identity:57/273 - (20%)
Similarity:107/273 - (39%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDSDTSEQAVRKQERDLKELLEWFRQ--NDKLP--KEIDPLLLRRFYQCMFGDVEETRKLIEVNY 82
            |..|.|.|.        :|.|..||:  .|.||  .:.|...|.|:.:....|::::..::..:.
  Rat     4 QVGDLSPQQ--------QEALTRFREILQDVLPTLPKADDFFLLRWLRARNFDLKKSEDMLRKHV 60

  Fly    83 ALRNRHPHLFIKRDPLDADSKRTFDYADILPL---PGLTPDKCKVSLYCFREFEASKMHH----T 140
            ..||:.          |.|...|:...:::.|   .||          |..::|...:..    |
  Rat    61 EFRNQQ----------DLDHILTWQPPEVIRLYDSGGL----------CGYDYEGCPVWFDLIGT 105

  Fly   141 EDTRAFFMVSDCRFVTPDDLAKPDV------LSEGEVQ-------------IFDMKGTTMRHISR 186
            .|.:..||.:     :..||.:..:      |.|.|:|             :|||:|.::||:.:
  Rat   106 LDPKGLFMSA-----SKQDLIRKRIKVCEMLLHECELQSQKLGRKVERMVMVFDMEGLSLRHLWK 165

  Fly   187 LTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEV-FKLIRFHTQSINTLYE 250
            ..:...:.:...|:..:|..::.:.:|..|.......::||.||.:.. .|::.........|.:
  Rat   166 PAVEVYQQFFAILEANYPETVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQELLK 230

  Fly   251 FVPREMLPEEYGG 263
            |:..:.||.|:||
  Rat   231 FMSPDQLPVEFGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 35/175 (20%)
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 11/45 (24%)
SEC14 76..244 CDD:214706 37/183 (20%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.