DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG11550

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_651882.1 Gene:CG11550 / 43731 FlyBaseID:FBgn0039864 Length:298 Species:Drosophila melanogaster


Alignment Length:288 Identity:72/288 - (25%)
Similarity:142/288 - (49%) Gaps:16/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEI-DPLLLRRFYQCMFGDVEETRKLIEVNYALR 85
            :|...|...:|:.|  :.:.|:|......:.... :...|..|:.|.: .:|..:::::.|...|
  Fly     7 EDQYASFPEIRRPE--VLKFLDWIHAQPHISDRFSEGEALHFFHACRY-SMEVAKQVLDTNLTAR 68

  Fly    86 NRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVS 150
            ......|:..|....:.:|......|:||||.||:..:|.|....:...|..:..:..:.:.||.
  Fly    69 THLEEFFVNLDCERPEIRRAMRTVSIVPLPGATPEGYRVILAKLDDLNTSNYNFADVMKLYCMVF 133

  Fly   151 DCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINC 215
            |  |...:|..:|     |.|.:.|:|.|::.|::|:.:..::.::.:||.|..:||...|.||.
  Fly   134 D--FWMYEDGIQP-----GHVIVIDLKNTSLGHVARIGLLQMKKFLYYLQEAAAIRLIGFHFINI 191

  Fly   216 PTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLEALRTHTQKALV 280
            ..::|:|::::.||:..|:..::..|: .:...|:|||:||||:||||........:....|.|:
  Fly   192 VPFMDKILALMTPFMKKELTTVLHMHS-DLKEFYKFVPQEMLPKEYGGQLEEANVAKEIYYKKLL 255

  Fly   281 EHRDYLMDPD--HWV--VVKPEKRNESS 304
            ::|..:::.:  |.|  .::|.|...:|
  Fly   256 DNRKEMIEFETRHQVNEKLRPGKAKNAS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 45/148 (30%)
CG11550NP_651882.1 CRAL_TRIO 94..239 CDD:279044 48/152 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26017
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.