DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG10657

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster


Alignment Length:263 Identity:64/263 - (24%)
Similarity:117/263 - (44%) Gaps:17/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPK-EIDPLLLRRFYQCMFGDVEETRKLIE 79
            |:|..:::       :|:|.  |.:..||..::..:.| ..|.:.|.||.:.....|....:::|
  Fly    41 EELHEDEN-------IRRQA--LAQFREWIEKHPHIRKCRTDTVFLLRFLRTKKFSVPSACEMLE 96

  Fly    80 VNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTR 144
            ....:|...|..|.:.|..|......|:...::|||.......:|......:|:..|....:..|
  Fly    97 RYLTIRQLFPQWFKQLDINDPAINEIFENGYLVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQMAR 161

  Fly   145 AFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRA 209
            ...:|  |..:..|:    |....|.|.|.|..|..|..:|..:::.||:.:|.:|.:.|:|.:.
  Fly   162 VHSLV--CEALLDDE----DSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNSTPMRHKE 220

  Fly   210 IHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLEALRTH 274
            .|.:|.|.|.:||:.:....:||::.|.|..| ::::.|...:...:||:||||.....:.:...
  Fly   221 THFVNIPHYANRIIELGVSMLSDKLKKRIIVH-KNVDILKTKIDPAILPKEYGGTVPIADMIAQF 284

  Fly   275 TQK 277
            .||
  Fly   285 KQK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 39/148 (26%)
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 11/47 (23%)
CRAL_TRIO 126..274 CDD:279044 41/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.