DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG32407

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster


Alignment Length:258 Identity:54/258 - (20%)
Similarity:94/258 - (36%) Gaps:46/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 DSDTSEQAVRKQERDLKELLEW------FRQNDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVN 81
            |.|.:.:.:.:.:..:.:.||.      |..||........|.:.:..|....|||:....:..|
  Fly     4 DQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68

  Fly    82 YALRNRHPHLFIKRDPLDADSKRTF----------DYADILPLPGLTPDKCKVSLYCFREFEASK 136
            .|.|..    |...|..:|:..:.|          ...|..||..||..|            .||
  Fly    69 LAWRKS----FGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKK------------HSK 117

  Fly   137 MHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIF-DMKGTTMRHISRLTISTLRAYIKFLQ 200
            ..:.||.....:....|.....:|.|        :.|| ||.|.   .:|.|.:..:::.|...:
  Fly   118 SRNQEDLLRILVFWIERLQRDSNLDK--------ITIFMDMTGA---GLSNLDMGFIKSIIGVFE 171

  Fly   201 LAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPEEYGG 263
            ..:|.....|.:.:.|..||....:||.|:..|..|:::..|:  ..:.::|.::...:.:||
  Fly   172 TKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTK--KDIDQYVDKDNCLKIWGG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 31/149 (21%)
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 35/166 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.