DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and Cralbp

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_523939.1 Gene:Cralbp / 38651 FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster


Alignment Length:315 Identity:71/315 - (22%)
Similarity:122/315 - (38%) Gaps:67/315 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRETG-ASGTSEQL----QRE--QDSDTSEQAVRKQERDLKELLEWFRQNDKLPK-EIDPLLLRR 62
            |::.| .:|..|.|    :||  :|..|.||:       |::|..|..:|:.|.. ..|...|.|
  Fly     2 VQDQGETTGLPEALLKIAKRELREDRCTREQS-------LEQLRNWVAKNEDLQNVRCDDTFLLR 59

  Fly    63 FYQCMFGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLP------------ 115
            |.:.....|....:.:.....:|...||:..:.|.|:.......|...|..:|            
  Fly    60 FLRAKKFSVPMAEQTLLKYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVI 124

  Fly   116 ---GLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIF--- 174
               ||.|   |:...|            :..:|.|:..:|            ::.:.|.||.   
  Fly   125 NAKGLNP---KIHTSC------------DQAKAHFLTYEC------------LMEDQETQITGLT 162

  Fly   175 ---DMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEV-F 235
               |..|.|..|::....:......|:.:.:.|:|.:.||:||.|:.|..::..||..:|.:: .
  Fly   163 HVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIHLINVPSTLKWLIDFVKNRVSSKMKN 227

  Fly   236 KLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLEALRTHTQKALVEHRDYLMDPD 290
            :||.:.::  ..|.:.|.:..||.|.||.....|.:....|: |...||.::..|
  Fly   228 RLIIYGSE--KELMKSVDQGCLPLEMGGKVPMREMIELWKQE-LATKRDLILGLD 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 35/170 (21%)
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 12/53 (23%)
SEC14 101..254 CDD:238099 38/181 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.