DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG32485

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_728794.1 Gene:CG32485 / 38363 FlyBaseID:FBgn0052485 Length:222 Species:Drosophila melanogaster


Alignment Length:266 Identity:54/266 - (20%)
Similarity:89/266 - (33%) Gaps:77/266 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TSEQAVRKQERDLKELLEWFRQNDKLPKEIDP------LLLRRFYQCM------FGDVEETR--- 75
            :||:.....|:|.|:|    ::..||..|.||      ..|||:.:..      |..:.:|.   
  Fly     2 SSEELAPINEQDFKDL----KERMKLIVEADPKQYHNDFSLRRYLRAFKTTDDAFQAILKTNKWR 62

  Fly    76 ------KLIEVNYALRNRHPHLFIKRDPL----------DADSKRTFDYADILPLPGLTPDKCKV 124
                  ||.|::.:..::...|...||.:          :..|:|..|......:..| .:.|| 
  Fly    63 ETYGVDKLSEMDRSQLDKKARLLRHRDCIGRPVIYIPAKNHSSERDIDELTRFIVYNL-EEACK- 125

  Fly   125 SLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTI 189
              .||.|                 |:| |.....|||:...                   |.:..
  Fly   126 --KCFEE-----------------VTD-RLCIVFDLAEFST-------------------SCMDY 151

  Fly   190 STLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPR 254
            ..::..|..|...||.||....:||.|.....|...::..:.|...|.::|...........:| 
  Fly   152 QLVQNLIWLLGKHFPERLGVCLIINSPGLFSTIWPAIRVLLDDNTAKKVKFVADEAELCQYLIP- 215

  Fly   255 EMLPEE 260
            ::||.:
  Fly   216 DILPTD 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 29/147 (20%)
CG32485NP_728794.1 CRAL_TRIO 85..219 CDD:279044 32/175 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447112
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.