DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG13893

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:273 Identity:59/273 - (21%)
Similarity:105/273 - (38%) Gaps:50/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGTSEQLQREQDSDTSEQAVRKQERDLKELLEWFRQ--NDKLPKEIDPLLLRRFYQCMFGDVEET 74
            ||...::..||                :.:||.||:  :|.|....|...|.|:.:....::|..
  Fly     2 SGPLPEISEEQ----------------RAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAA 50

  Fly    75 RKLIEVNYALRNR---HPHLFIKRDPLDADSKRTFDYADILP--LPGLTPDKCKVSLYCFREFEA 134
            .|::..  :|:.|   :.....|.||..|       ..:.||  |.|...:...|.:..|..|:.
  Fly    51 EKMLRA--SLKTRAMWNVDNIEKWDPPKA-------LQEYLPYGLMGYDNEGSPVLVCPFANFDM 106

  Fly   135 SKMHHTE---DTRAFFMVSDCRF--VTPDDLAKPDVLSEGEVQIFDMKGTTM-----RHISRLTI 189
            ..|.|..   :.:.:.::...||  :..|...|....:...|..|||:...:     |..:...|
  Fly   107 WGMMHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVI 171

  Fly   190 STLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSIN----TLYE 250
            ||::.|    :..||..|:..::||.|.......::||.|:.:.....|..:...::    .|:.
  Fly   172 STVKQY----EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFS 232

  Fly   251 FVPREMLPEEYGG 263
            .|.|:..|:.:||
  Fly   233 HVNRKAFPKAWGG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 34/162 (21%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 11/42 (26%)
SEC14 75..246 CDD:238099 39/182 (21%)
GOLD_2 303..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.