DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG13893

DIOPT Version :10

Sequence 1:NP_726804.1 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_612042.3 Gene:CG13893 / 38074 FlyBaseID:FBgn0035146 Length:407 Species:Drosophila melanogaster


Alignment Length:273 Identity:59/273 - (21%)
Similarity:105/273 - (38%) Gaps:50/273 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGTSEQLQREQDSDTSEQAVRKQERDLKELLEWFRQ--NDKLPKEIDPLLLRRFYQCMFGDVEET 74
            ||...::..||                :.:||.||:  :|.|....|...|.|:.:....::|..
  Fly     2 SGPLPEISEEQ----------------RAILEKFRKQMDDALVGTHDDYFLVRWLRARKWNLEAA 50

  Fly    75 RKLIEVNYALRNR---HPHLFIKRDPLDADSKRTFDYADILP--LPGLTPDKCKVSLYCFREFEA 134
            .|::..  :|:.|   :.....|.||..|       ..:.||  |.|...:...|.:..|..|:.
  Fly    51 EKMLRA--SLKTRAMWNVDNIEKWDPPKA-------LQEYLPYGLMGYDNEGSPVLVCPFANFDM 106

  Fly   135 SKMHHTE---DTRAFFMVSDCRF--VTPDDLAKPDVLSEGEVQIFDMKGTTM-----RHISRLTI 189
            ..|.|..   :.:.:.::...||  :..|...|....:...|..|||:...:     |..:...|
  Fly   107 WGMMHCVTRFEFQKYLVLLLERFMKIAYDQSQKHGWRARQLVVFFDMQDVNLKQYAWRPAAECVI 171

  Fly   190 STLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSIN----TLYE 250
            ||::.|    :..||..|:..::||.|.......::||.|:.:.....|..:...::    .|:.
  Fly   172 STVKQY----EANFPELLKMCYIINAPKLFSVAFNIVKKFLDENTTSKIVIYKSGVDRWQEQLFS 232

  Fly   251 FVPREMLPEEYGG 263
            .|.|:..|:.:||
  Fly   233 HVNRKAFPKAWGG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_726804.1 SEC14 106..263 CDD:214706 36/172 (21%)
CG13893NP_612042.3 CRAL_TRIO_N 16..57 CDD:215024 11/42 (26%)
CRAL_TRIO 81..245 CDD:459890 36/167 (22%)
GPCR_chapero_1 303..381 CDD:480652
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.