DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and Clvs2

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001101929.1 Gene:Clvs2 / 361459 RGDID:1306801 Length:236 Species:Rattus norvegicus


Alignment Length:231 Identity:47/231 - (20%)
Similarity:86/231 - (37%) Gaps:51/231 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QLQREQDSDTSEQAVRKQERDL---KELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVEETRKLI 78
            :|:..::.||..|.: ::.||:   :..:.:.|.:|......  |..|:|:..      |..:|:
  Rat    17 RLELNENPDTLHQDI-QEVRDMVITRPDIGFLRTDDAFILRF--LRARKFHHF------EAFRLL 72

  Fly    79 EVNYALRNRHPHLFIKRDPLDADSKRTFDYADILP--LPGLTPDKCKVSLYCFREFEASKMHHTE 141
            ...:..|.::..:|......|...|:..  .|..|  |..|.....|:.:.....::.|:....:
  Rat    73 AQYFEYRQQNLDMFKSFKATDPGIKQAL--KDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVD 135

  Fly   142 DTRAFF-----MVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQL 201
            ..||..     |:.|           |::...|.|.|.|....|.:..|:||.|.||..|:.|| 
  Rat   136 ILRAILLSLEAMIED-----------PELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQ- 188

  Fly   202 AFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKL 237
                    :.:.:|..:          |:|..:|.|
  Rat   189 --------VRVYHCYCF----------FVSYMLFAL 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 28/129 (22%)
Clvs2NP_001101929.1 CRAL_TRIO_N 29..75 CDD:215024 10/54 (19%)
SEC14 103..>204 CDD:301714 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.