DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG12926

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster


Alignment Length:274 Identity:67/274 - (24%)
Similarity:133/274 - (48%) Gaps:13/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SEQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQ-CMFGDVEETRKLI 78
            |.:|.::...:..|...|..| |::.|..|..:...|....|...|..|.: |.: .:|:|:..:
  Fly    13 SPELAKKAHDELGEIPDRIDE-DIETLRTWISKQPHLKARQDAQFLVAFLRGCKY-SLEKTKLKL 75

  Fly    79 EVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLP-GLTPDKCKVSLYCFREFEASKMHHTED 142
            :..||:|...|.|: |...:........|...:|.|| .|..|..::.:..:.::::.|....|.
  Fly    76 DNFYAMRGAVPELY-KNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYDSKKYSIAEV 139

  Fly   143 TRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRL 207
            .:...|:.:.: :..||    :.:..|.|:|.||||....|:.:.....::........|:|.|.
  Fly   140 VQVNTMLGEIQ-IREDD----NAMISGFVEIIDMKGVGAGHLFQFDAVLVKKLAVLGDKAYPYRP 199

  Fly   208 RAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQS-INTLYEFVPREMLPEEYGGGAGSLEAL 271
            :..|.:|.|:..::.:|:.|..:|:::.|  |||..| :::||::||:|.||.||||..|:::.:
  Fly   200 KGFHFVNAPSSAEKFMSIAKSLMSEKIRK--RFHIHSKLDSLYKYVPKECLPAEYGGSNGTIQDV 262

  Fly   272 RTHTQKALVEHRDY 285
            .:..:..|:.::.:
  Fly   263 VSTWRTKLLAYKPF 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 40/150 (27%)
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 11/46 (24%)
SEC14 117..254 CDD:238099 37/143 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447096
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.