DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG1902

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster


Alignment Length:308 Identity:67/308 - (21%)
Similarity:115/308 - (37%) Gaps:54/308 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVN 81
            ::.|.|..:.....|.|    ::.|..|..:...|....|...|..|.:....||||.:|.:...
  Fly    13 EVARTQLCEDPSSTVAK----IEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFY 73

  Fly    82 YALRNRHPHLFIKRDPLDADSK-----RTFDYADILPLP--------------GLTPDKCKVS-L 126
            |..:::...|...|   ..|.|     |:..:| .||.|              .:.|.|..|| :
  Fly    74 YTYKSKERELLKGR---QVDDKLIELARSGIFA-TLPKPIGPGGPRIHYTRMGHIEPSKHSVSDI 134

  Fly   127 YCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTIST 191
            :.|..|.|....:|:|..              ::|       |.|:|.|........:.:.....
  Fly   135 FRFHAFRAEIEINTDDNW--------------NIA-------GVVEIIDFTKIPYSLLLQFDPGM 178

  Fly   192 LRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREM 256
            .:....||:...|..|.|.|::|.......::.:|:..:..:  :|:..|: ::.:|.:.:..|.
  Fly   179 FKRMNAFLEHGIPANLVATHIVNASRETQFVLGLVRNVMKQK--ELLHIHS-TVASLRKAIGLEY 240

  Fly   257 LPEEYGGGAGSLEALRTHTQKALVEHRDYLMDPDHWVVVKPEKRNESS 304
            ||.|.||..|||....|..:..|:....|..:.:.:.|  .||..|:|
  Fly   241 LPVEMGGDNGSLSDAMTRYETQLLSFSPYFTEDERYGV--DEKLREAS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 30/163 (18%)
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 11/44 (25%)
CRAL_TRIO 100..248 CDD:279044 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447095
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.