DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG10026

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_609968.3 Gene:CG10026 / 35226 FlyBaseID:FBgn0032785 Length:299 Species:Drosophila melanogaster


Alignment Length:277 Identity:65/277 - (23%)
Similarity:122/277 - (44%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TGASGTSEQLQREQDSDTSEQAVRKQERDLKE-----------LLEWFR-----QNDKLPKEIDP 57
            |.:||.......|...:.:|:.|.:..|.|.:           ::|.||     .|:..|...|.
  Fly     2 TTSSGCRTMPTIEHKLNITEEEVPEHIRRLAQEQGECPSSKDKVIEQFRNYILEHNECQPHRSDA 66

  Fly    58 LLLRRFYQCMFGDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDK- 121
            ..|.:|.:..:..:|.:.||:...|..|.::...:.|..|||.   |....:|||.   :||.: 
  Fly    67 KYLEKFLRARYWKIENSYKLLCSYYRFREQNKSFYEKVRPLDL---RHVGQSDILT---VTPYRD 125

  Fly   122 ---CKVSLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSE--GEVQIFDMKGTTM 181
               .::.:|.|..:..:::...:..||..::.:...:.|        :|:  |.|.|||:|...:
  Fly   126 QHGHRILIYRFGLWRPNQVTVDDIFRATIVLQELGSLEP--------ISQIVGGVGIFDLKDLGL 182

  Fly   182 RHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSIN 246
            .||..|:.|..:..|..|..:.|:|..|:|::|.....:....:.|||::..:.:.:..|...:.
  Fly   183 EHILHLSPSVAQKMIALLVTSMPIRTSALHIVNQNWVFNAAFKIFKPFLNAAMREKLYIHGSDMT 247

  Fly   247 TLYEFVPREMLPEEYGG 263
            :|::.:..|.||:.|||
  Fly   248 SLHKHINPEHLPKRYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 34/154 (22%)
CG10026NP_609968.3 CRAL_TRIO_N 43..90 CDD:215024 11/46 (24%)
SEC14 112..265 CDD:238099 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.