DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG5958

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:306 Identity:67/306 - (21%)
Similarity:130/306 - (42%) Gaps:50/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRIGVRETGASGTSEQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQ 65
            ::|:.:|||      |:::.|        |:.|    |:|||   :...:|..:.|...|..|.:
  Fly    25 IARVELRET------EEVKAE--------AIIK----LRELL---KATPELNYKDDDAFLTVFLR 68

  Fly    66 -CMF---GDVEETRKLIEVNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCK--V 124
             |.|   |.:|:    ::...:.|..:..|.  |..|....|..|....::.:......|.:  :
  Fly    69 ACHFYPEGALEK----MKTTASFRKEYASLV--RGLLVEQVKEKFVKGSVINVLKNCDQKGRRVL 127

  Fly   125 SLYCFREFEASKMHHTEDTRAFFMVSDCRFVTPDDLA---KPDVLSEGEVQIFDMKGTTMRHISR 186
            .:.|.:.::.|.:...|..|..:||         .||   :.:....|.|.|.|.:|.:|:.:..
  Fly   128 IVNCGKLWDPSDITSDEMFRMLYMV---------HLAAQLEEETQVRGVVCIMDFEGLSMKQVKA 183

  Fly   187 LTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEF 251
            |:.|..:..:.|:|.|.|:|::.:|.:..|...:.:.|:.|||:..::...:.||...:.:|.:|
  Fly   184 LSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKF 248

  Fly   252 VPREMLPEEYGGGAGSLEALRTHTQKALVEHRDYL-----MDPDHW 292
            :...:||..|.|...:::........||.:...|:     :.|..|
  Fly   249 LDPSVLPANYKGTLPAIDYGGVEWFPALEQQAQYVEEWSQLGPAQW 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 35/153 (23%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 15/62 (24%)
CRAL_TRIO 111..261 CDD:279044 35/158 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1053004at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.