DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG33514

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster


Alignment Length:289 Identity:72/289 - (24%)
Similarity:125/289 - (43%) Gaps:40/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 EQLQREQDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQ-CMFGDVEETRKLIE 79
            :::.:||..:..|    :.|.||:....|..|...|...:|...|..|.: |.: .:|..:..::
  Fly    13 QKVAKEQLKEDPE----RLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKY-SLERAKSKLD 72

  Fly    80 VNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLP---------------GLTPDKCKVSLYCF 129
            ..|.|:.::|..|...:..|:..:.......|:.||               ||.|.:....|.|.
  Fly    73 KYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWRMGLVPVEKYTMLECM 137

  Fly   130 REFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRA 194
            :..:|  |....             :..||.|..:    |.|.|.||||.|..|:.::|.|..:.
  Fly   138 QVAQA--MQEIA-------------ILEDDYANVN----GVVFIMDMKGATAAHLFQMTPSMAKK 183

  Fly   195 YIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPE 259
            :..|.:.|.|:||:|.|.||..|..:::.::.||.:|.::...:..|...:..|.|.:|.:.|||
  Fly   184 FTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPE 248

  Fly   260 EYGGGAGSLEALRTHTQKALVEHRDYLMD 288
            ||||..|:.:.:....:|.|.|:.|:..:
  Fly   249 EYGGENGTTQDIVAAMEKKLDEYADFFQE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 45/163 (28%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 11/46 (24%)
SEC14 97..253 CDD:238099 47/174 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447099
Domainoid 1 1.000 50 1.000 Domainoid score I4355
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.