DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and Ttpal

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:259 Identity:72/259 - (27%)
Similarity:118/259 - (45%) Gaps:28/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SEQAVRKQERDLKELLEWFRQN-----DKLPKE-------IDPLLLRRFYQCMFGDVEETRKLIE 79
            :|..|.|...:|:|..||..::     |.:.||       :|...|.||.:....|.:...:|: 
  Rat    37 TEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLL- 100

  Fly    80 VNY-ALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFR--EFEASKMHHTE 141
            ||| ..|...|.:|....|  :..|...:...:..||...|..|.|  .|.|  .:..|....||
  Rat   101 VNYHGCRRSWPEVFSNLRP--SALKDVLNSGFLTVLPHTDPRGCHV--LCIRPDRWIPSNYPITE 161

  Fly   142 DTRAFFMVSDCRFVTPDDLAKPDVLS-EGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPV 205
            :.||.::       |.:.|.:.:... .|.|.:.|.||.::...|.......|..|..||..||:
  Rat   162 NIRAIYL-------TLEKLIQSEETQVNGVVILADYKGVSLSKASHFGPFIARKVIGILQDGFPI 219

  Fly   206 RLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPEEYGGGAGSLE 269
            |::|:|::|.|.....|.:::|||:.:::......|...:::|:..:||.:||:||||.||.|:
  Rat   220 RIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLSSLHTSLPRNILPKEYGGTAGELD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 43/151 (28%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 10/46 (22%)
SEC14 122..278 CDD:238099 45/164 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10174
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.