DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and Rlbp1

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:265 Identity:67/265 - (25%)
Similarity:122/265 - (46%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LQREQD-----SDTSEQAVRKQERDLKELLE-WFRQNDKLPKEI-------DPLLLRRFYQCMFG 69
            ||:.:|     .:|.::||    |:|:||:: .....::|...:       |...|.||.:....
  Rat    45 LQKAKDELNEREETRDEAV----RELQELVQAQAASGEELAVAVAERVQARDSAFLLRFIRARKF 105

  Fly    70 DVEETRKLIE--VNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCK----VSLYC 128
            ||....:|::  ||:.|  ::|.||   |.|..::.|....|.   .||:...:.|    |.|:.
  Rat   106 DVGRAYELLKGYVNFRL--QYPELF---DSLSMEALRCTIEAG---YPGVLSSRDKYGRVVMLFN 162

  Fly   129 FREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLR 193
            ...:...::...|..:|:     | |:....|...:....|...:.:.||.||:..:.|..|.|:
  Rat   163 IENWHCEEVTFDEILQAY-----C-FILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLK 221

  Fly   194 AYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLP 258
            ..:..||.:||.|.:|||.|:.|.|.....:|||||:.:::.:.:..|...::..::.:...:||
  Rat   222 KMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILP 286

  Fly   259 EEYGG 263
            .::||
  Rat   287 ADFGG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 37/152 (24%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 14/60 (23%)
CRAL_TRIO 143..292 CDD:279044 39/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.