DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CG30339

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:300 Identity:80/300 - (26%)
Similarity:146/300 - (48%) Gaps:32/300 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SEQLQREQDSDTSEQAVRKQER---DLKELLEWFRQNDKLPKEIDPLLLRRFYQ-CMFGDVEETR 75
            |.:|:|..:::.:|    .:||   |||.|.:|..:...|....|...|..|.: |.| .:|:|:
  Fly     8 SAELRRIAETELNE----VEERVPADLKALRDWLAKQPHLRARQDDQFLVGFLRGCKF-SLEKTK 67

  Fly    76 KLIEVNYALRNRHPHLFIKR--DPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMH 138
            ..::..|.::...|.||.||  |..:....|:..|.. ||.|..| |..::.|..:.:|      
  Fly    68 SKLDHFYTIKTLMPELFGKRLVDERNLILCRSGTYVR-LPKPWGT-DGPRLQLTNYEKF------ 124

  Fly   139 HTEDTRAFFMVSDCRF---VTPDDLAKPDVLS-EGEVQIFDMKGTTMRHISRLTISTLRAYIKFL 199
               |.:.|.::...|:   :|...:.:.|..: .|.|:|.||...::..:::|..:.::....|.
  Fly   125 ---DPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFA 186

  Fly   200 QLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHT-QSINTLYEFVPREMLPEEYGG 263
            :.|.|.||:.:|:||||.....::::.|..:..::.:  |||. :::..|.|.:|||.|||||||
  Fly   187 EKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQ--RFHVYKNLEQLNEVIPREYLPEEYGG 249

  Fly   264 GAGSLEALRTHTQKALVEHRDYLMDPDHWVV---VKPEKR 300
            ..|.:..::...:|.|:.:..|..:...:.|   ::|.||
  Fly   250 NNGRIADIQAEAEKKLLSYESYFAEDSQYGVDEQLRPGKR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 40/153 (26%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 13/42 (31%)
CRAL_TRIO 109..250 CDD:279044 40/152 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.