DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and Rlbp1

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001166954.1 Gene:Rlbp1 / 19771 MGIID:97930 Length:317 Species:Mus musculus


Alignment Length:288 Identity:73/288 - (25%)
Similarity:131/288 - (45%) Gaps:41/288 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LQREQD-----SDTSEQAVRKQERDLKELLE-WFRQNDKLPKEI-------DPLLLRRFYQCMFG 69
            ||:.:|     .:|.|:||    |:|:||:: .....::|...:       |...|.||.:....
Mouse    45 LQKAKDELNEKEETREEAV----RELQELVQAQAASGEELALAVAERVQARDSAFLLRFIRARKF 105

  Fly    70 DVEETRKLIE--VNYALRNRHPHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCK----VSLYC 128
            ||....:|::  ||:.|  ::|.||   |.|..::.|....|.   .||:...:.|    |.|:.
Mouse   106 DVGRAYELLKGYVNFRL--QYPELF---DSLSMEALRCTIEAG---YPGVLSSRDKYGRVVMLFN 162

  Fly   129 FREFEASKMHHTEDTRAFFMVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLR 193
            ...:...::...|..:|:     | |:....|...:....|...:.:.||.||:..:.|..|.|:
Mouse   163 IENWHCEEVTFDEILQAY-----C-FILEKLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLK 221

  Fly   194 AYIKFLQLAFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLP 258
            ..:..||.:||.|.:|||.|:.|.|.....:|||||:.:::.:.:..|...::..::.:...:||
Mouse   222 KMVDMLQDSFPARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILP 286

  Fly   259 EEYGGGA----GSLEALRTHTQKALVEH 282
            .::||..    |.:.|.:....:|.||:
Mouse   287 ADFGGTLPKYDGKVVAEQLFGPRAEVEN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 37/152 (24%)
Rlbp1NP_001166954.1 CRAL_TRIO_N 60..117 CDD:215024 15/60 (25%)
CRAL_TRIO 143..292 CDD:395525 38/157 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835985
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.