DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and cgr-1

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:241 Identity:47/241 - (19%)
Similarity:84/241 - (34%) Gaps:66/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TSEQAVRKQERDLKELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVEETRKLIEVNY--ALRNRH 88
            ||...:.:..:::..:.|:|.                      |.:....|..:|.|  |:...|
 Worm    80 TSVDQINRDIKNMSAVAEYFP----------------------GGIMGKSKRGDVVYMQAMAKAH 122

  Fly    89 PHLFIKRDPLDADSKRTFDYADILPLPGLTPDKCKVSLYCFREFEASKMHHTEDTRAFFMVSDCR 153
            |...:|..|    :.:.|.                   .|..|.|.|          |.::....
 Worm   123 PKTLVKAGP----TSQLFQ-------------------LCISETEMS----------FKIIRQTE 154

  Fly   154 FVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTY 218
            ..|...:        |.:.|.|:.|.:|..:...|:....:.:..||..||...|.|::||||..
 Worm   155 QETERKM--------GVIIIMDLDGFSMDLLYTPTLKVYMSLLTMLQNIFPDFARRIYIINCPAM 211

  Fly   219 LDRIVSVVKPFISDEVFKLIRFHTQS-INTLYEFVPREMLPEEYGG 263
            :..:.::|.|.:|.:..:.:||..:. .|.|.|.:..|.:...:||
 Worm   212 MSAVYAMVSPVLSSQTREKVRFLDKDWKNHLIEEIGEENIFMHWGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 31/149 (21%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 43/228 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.