DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and C34C12.6

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:290 Identity:66/290 - (22%)
Similarity:111/290 - (38%) Gaps:81/290 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QDSDTSEQAVRKQERDLKELLEWFRQNDKLPKEI-----DPLLLRRFYQCMFGDVEETRKLIEVN 81
            :.|:....:.|.|...::.:|:     :|||..|     ..|.|.|:.:...||   |.||:: |
 Worm     8 RSSEPITDSERSQINSVRAMLQ-----EKLPDGIPDDVNTDLNLCRWIRGYHGD---TEKLVK-N 63

  Fly    82 YA--LRNRHPHLFIKRDPLDADSKRTFDYAD-ILPLPGLTPDKCKVSLYCFREFEASK----MHH 139
            :|  |.:|....|:..           |:|: ...||.:.|         |.:|.||.    ...
 Worm    64 FATYLASRKAAGFVGN-----------DFAEKFFELPSIAP---------FLQFIASSRLQDRQW 108

  Fly   140 TEDTRAFFMVSDC---------RFVTPDDL-----------------AKPDVLSEGEVQ---IFD 175
            :::..||..|...         .|.|.|.|                 .|.....:|.||   |||
 Worm   109 SDEHNAFLFVERAWSQPKEFIKTFKTSDYLLHCFGYSEMLQQLILRREKKQSADKGPVQFIVIFD 173

  Fly   176 MKGTTMRHISRLTISTLRAYIKFLQLA-------FPVRLRAIHMINCPTYLDRIVSVVKPFISDE 233
            :....:...    ::.:..|:|..|:.       ||..::.|::.|.|..|..:..|.:.|:|:|
 Worm   174 LNTVNITDY----VNPMSGYMKLWQIRSELWQDWFPEMVQRIYLTNPPRLLGLLWKVARVFLSEE 234

  Fly   234 VFKLIRFHTQSINTLYEFVPREMLPEEYGG 263
            ..|.|...:...:...:|:|..::|:||||
 Worm   235 NLKRIEIISDKSDLAGKFLPPWLVPKEYGG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 41/188 (22%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 41/187 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.