powered by:
Protein Alignment CG3191 and H41C03.1
DIOPT Version :9
Sequence 1: | NP_001245486.2 |
Gene: | CG3191 / 31209 |
FlyBaseID: | FBgn0023525 |
Length: | 309 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_495168.1 |
Gene: | H41C03.1 / 173994 |
WormBaseID: | WBGene00019268 |
Length: | 396 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 10/65 - (15%) |
Similarity: | 31/65 - (47%) |
Gaps: | 3/65 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 202 AFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRF---HTQSINTLYEFVPREMLPEEYGG 263
|:|..:..:.:||.|:::..:...:.|.:.:.....:|. ::....::.:....:.:|:.:||
Worm 175 AYPEWINTLFLINAPSFMTLLWKAIGPLLPERTRNKVRICSGNSDWKTSVQKHAHIDNIPKHWGG 239
Fly 264 263
Worm 240 239
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3191 | NP_001245486.2 |
SEC14 |
114..263 |
CDD:238099 |
8/63 (13%) |
H41C03.1 | NP_495168.1 |
SEC14 |
69..242 |
CDD:214706 |
10/65 (15%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1471 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.