DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3191 and CLVS2

DIOPT Version :9

Sequence 1:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster
Sequence 2:NP_001010852.2 Gene:CLVS2 / 134829 HGNCID:23046 Length:327 Species:Homo sapiens


Alignment Length:257 Identity:64/257 - (24%)
Similarity:115/257 - (44%) Gaps:32/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QLQREQDSDTSEQAVRKQERDL---KELLEWFRQNDKLPKEIDPLLLRRFYQCMFGDVEETRKLI 78
            :|:..::.||..|.: ::.||:   :..:.:.|.:|......  |..|:|:..      |..:|:
Human    17 RLELNENPDTLHQDI-QEVRDMVITRPDIGFLRTDDAFILRF--LRARKFHHF------EAFRLL 72

  Fly    79 EVNYALRNRHPHLFIKRDPLDADSKRTFDYADILP--LPGLTPDKCKVSLYCFREFEASKMHHTE 141
            ...:..|.::..:|......|...|:..  .|..|  |..|.....|:.:.....::.|:....:
Human    73 AQYFEYRQQNLDMFKSFKATDPGIKQAL--KDGFPGGLANLDHYGRKILVLFAANWDQSRYTLVD 135

  Fly   142 DTRAFF-----MVSDCRFVTPDDLAKPDVLSEGEVQIFDMKGTTMRHISRLTISTLRAYIKFLQL 201
            ..||..     |:.|           |::...|.|.|.|....|.:..|:||.|.||..|:.||.
Human   136 ILRAILLSLEAMIED-----------PELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQD 189

  Fly   202 AFPVRLRAIHMINCPTYLDRIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPEEYGG 263
            :||.|...||.:|.|.|:..:.:|::||:.::..|.|..|..::|:|::.:..|:||.|:||
Human   190 SFPARFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGG 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 43/153 (28%)
CLVS2NP_001010852.2 CRAL_TRIO_N 29..75 CDD:215024 10/54 (19%)
SEC14 106..251 CDD:238099 43/155 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145895
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.