DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or98a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:387 Identity:82/387 - (21%)
Similarity:155/387 - (40%) Gaps:61/387 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTITITDIVAN-------LKFA 88
            |....::|.:.|..:.....|..|:.::  :.|.|::.....|..:|:..:..|       :.|.
  Fly    36 PATHKIIYYITSCLIFAWCAVYLPIGII--ISFKTDINTFTPNELLTVMQLFFNSVGMPFKVLFF 98

  Fly    89 NVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFASIFVF---------G 144
            |:|:  ...::.:.||..||.|.         :.|::.|.:.||..|...:..::         .
  Fly    99 NLYI--SGFYKAKKLLSEMDKRC---------TTLKERVEVHQGVVRCNKAYLIYQFIYTAYTIS 152

  Fly   145 TTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLCLL 209
            |.||.......|.|  :|..:  ||:..|..::....:.:...::....|...||.||..:..:|
  Fly   153 TFLSAALSGKLPWR--IYNPF--VDFRESRSSFWKAALNETALMLFAVTQTLMSDIYPLLYGLIL 213

  Fly   210 TGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRL--------REIIQR 266
            ..|::.|.|||..:...:.||:         .|..|:||:||:|    |.|        |..:.|
  Fly   214 RVHLKLLRLRVESLCTDSGKSD---------AENEQDLIKCIKD----HNLIIDYAAAIRPAVTR 265

  Fly   267 VLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSE 331
            .:.|..:...:|.....    ::.|:.||.....|   ::.:.:.:.::.|..|:..|.::...|
  Fly   266 TIFVQFLLIGICLGLSM----INLLFFADIWTGLA---TVAYINGLMVQTFPFCFVCDLLKKDCE 323

  Fly   332 ALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393
            .|..|.:..|||.....:|..|.:.|...|:.....||:...:|..:..:|.:..:||.|.:
  Fly   324 LLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIAFTAGSIFPISTGSNIKVAKLAFSVVTFV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 72/344 (21%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 72/339 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.