DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or94a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:379 Identity:88/379 - (23%)
Similarity:164/379 - (43%) Gaps:35/379 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 WELTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTITITDIVANLK 86
            |..||.::..         |...::|.:|..|...:......::|:....:.|.::||::...:|
  Fly    34 WTFTGFVKRN---------YRFLLHLPITFTFIGLMWLEAFISSNLEQAGQVLYMSITEMALVVK 89

  Fly    87 FANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFASIFV---FGTTLS 148
            ..:::..|.:..  |.:..|..|....:.:.||:...|:|    |..|:.|..|::   .|...|
  Fly    90 ILSIWHYRTEAW--RLMYELQHAPDYQLHNQEEVDFWRRE----QRFFKWFFYIYILISLGVVYS 148

  Fly   149 -CVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLCLLTGH 212
             |..|:.....||.:..:...:|.:. |.|.....|.:.|:.:..|.|...|:....||..::..
  Fly   149 GCTGVLFLEGYELPFAYYVPFEWQNE-RRYWFAYGYDMAGMTLTCISNITLDTLGCYFLFHISLL 212

  Fly   213 MRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDL-ARVHRLREIIQRVLSVPCMAQF 276
            .|.|.||:|.     .|:.|..|       ::.:.:..|..: .|:..|....||::|...::|.
  Fly   213 YRLLGLRLRE-----TKNMKNDT-------IFGQQLRAIFIMHQRIRSLTLTCQRIVSPYILSQI 265

  Fly   277 VCSAAVQCTVAMHFLYVADDHDHTAMIISIV-FFSAVTLEVFVICYFGDRMRTQSEALCDAFYDC 340
            :.||.:.|.......:|. ..|:....||:: |.|.:.|::::.||:|:.:...:..|.:..|..
  Fly   266 ILSALIICFSGYRLQHVG-IRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHT 329

  Fly   341 NWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLL 394
            ||:|..|..::.|...:...::|..|.|||:.|:.|..|.:.:...||...|||
  Fly   330 NWLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALLL 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 76/326 (23%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 76/326 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466067
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27053
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.