DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or85f

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524289.1 Gene:Or85f / 41119 FlyBaseID:FBgn0037685 Length:392 Species:Drosophila melanogaster


Alignment Length:255 Identity:53/255 - (20%)
Similarity:109/255 - (42%) Gaps:56/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PDRELLYPAW-----FGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRA 215
            |:::   |.|     :.::|:|||:               ..|.|..:|.:...|...:..|.|.
  Fly   176 PEKD---PVWIYISIYALEWLHSTQ---------------MVISNIGADIWLLYFQVQINLHFRG 222

  Fly   216 LELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSA 280
            :   :|.:..........|....:..::..:.:..:       .|:..:..:.....:...:.:|
  Fly   223 I---IRSLADHKPSVKHDQEDRKFIAKIVDKQVHLV-------SLQNDLNGIFGKSLLLSLLTTA 277

  Fly   281 AVQCTVAMH----------FLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCD 335
            ||.||||::          |.||             :|.....::|:::||:|.::...|..:..
  Fly   278 AVICTVAVYTLIQGPTLEGFTYV-------------IFIGTSVMQVYLVCYYGQQVLDLSGEVAH 329

  Fly   336 AFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLR 395
            |.|:.::.:....:||.||..:.|.|:|..:.|..|:::||:||:|:|..:|.|.|:|::
  Fly   330 AVYNHDFHDASIAYKRYLLIIIIRAQQPVELNAMGYLSISLDTFKQLMSVSYRVITMLMQ 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 49/245 (20%)
Or85fNP_524289.1 7tm_6 68..381 CDD:251636 49/245 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465903
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.