DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or85a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:412 Identity:86/412 - (20%)
Similarity:169/412 - (41%) Gaps:77/412 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SAVYYHWRV----WELTGLMRPPGVSSL--LYVVYSITVNLVVTVLFPLSLLARLLFTTNMAGLC 71
            |.:|.:..:    |.|     ||.....  ||.::::.|.::|.:..|..|:        |.|:.
  Fly    20 SLIYLNRSIDQMGWRL-----PPRTKPYWWLYYIWTLVVIVLVFIFIPYGLI--------MTGIK 71

  Fly    72 ENLTITITDI-----------VANLKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEI---SA 122
            |....|.||:           .:.:|...|..:|::....:.::..||.|...:.:..::   :|
  Fly    72 EFKNFTTTDLFTYVQVPVNTNASIMKGIIVLFMRRRFSRAQKMMDAMDIRCTKMEEKVQVHRAAA 136

  Fly   123 L-RKEVNIAQGTFRTFASI-----FVFGTTLSCV-RVVVRPDRELLYPAWFGVDWMHSTRNYVLI 180
            | .:.|.|....:..:.|:     .|.|.|..|: ..:|.|| :..|.|             ..|
  Fly   137 LCNRVVVIYHCIYFGYLSMALTGALVIGKTPFCLYNPLVNPD-DHFYLA-------------TAI 187

  Fly   181 NIYQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQ 245
            ....:.|:|   :.|...|.||..::.:|..||..|..|::.:....||.:         ::.|.
  Fly   188 ESVTMAGII---LANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGD---------DQHYA 240

  Fly   246 ELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAAV--QCTVAMHFLYVADDHDHTAM--IISI 306
            ||:||::|...:......::.::|.....|.:....:  ...|:|.|.       :|.|  ::|.
  Fly   241 ELVECVKDHKLIVEYGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFY-------NTVMERVVSG 298

  Fly   307 VFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNY 371
            |:..|:..:.|..||..:::.:..|:|.:..:...||....:::..:|:.:...|:..|..||..
  Fly   299 VYTIAILSQTFPFCYVCEQLSSDCESLTNTLFHSKWIGAERRYRTTMLYFIHNVQQSILFTAGGI 363

  Fly   372 IALSLETFEQVMRFTYSVFTLL 393
            ..:.|.|..::.:|.:||.|::
  Fly   364 FPICLNTNIKMAKFAFSVVTIV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 71/345 (21%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 68/334 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.