DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Orco

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:499 Identity:89/499 - (17%)
Similarity:165/499 - (33%) Gaps:155/499 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RVWELTGLMRP--PGVSSLLYVVYSITVNLVVTVLFPLSLLARLLF-TTNMAGLCENLTITITDI 81
            |..:.:||...  .|.|:.:..||| :|:||.       ||.:..| ..|||...|.:.....:.
  Fly    22 RAMKYSGLFMHNFTGGSAFMKKVYS-SVHLVF-------LLMQFTFILVNMALNAEEVNELSGNT 78

  Fly    82 VANLKFAN-----VYMVRKQLHEIRS-----------LLRLMDARARLVGDPEEISALRK----- 125
            :..|.|.:     :|:...|.:..|:           |....|||...:.    ::.:||     
  Fly    79 ITTLFFTHCITKFIYLAVNQKNFYRTLNIWNQVNTHPLFAESDARYHSIA----LAKMRKLFFLV 139

  Fly   126 -EVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDREL---------------LYPAWFGVDWMHST 174
             ...:|..|  .:.:|..||.:   |::||  |.|.               .||      |..|.
  Fly   140 MLTTVASAT--AWTTITFFGDS---VKMVV--DHETNSSIPVEIPRLPIKSFYP------WNASH 191

  Fly   175 RNYVLINI-----YQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCR--TEKSNK 232
            ..:.:|:.     |.||.:|...:.:....|: ..|.|....|::.:...:..:...  |.:.|.
  Fly   192 GMFYMISFAFQIYYVLFSMIHSNLCDVMFCSW-LIFACEQLQHLKGIMKPLMELSASLDTYRPNS 255

  Fly   233 GQTYEAWREEVYQELIE-------CIRDLARVHRLREIIQRVLSVPCMAQFVCSAAVQ------- 283
            ...:.:.......|||.       ...|::.::..:        ....|||...:.:|       
  Fly   256 AALFRSLSANSKSELIHNEEKDPGTDMDMSGIYSSK--------ADWGAQFRAPSTLQSFGGNGG 312

  Fly   284 -------------------CTVAMHFLYVADDHDHTAMIISIV---FFSAVTL------------ 314
                               ..|.....|..:.|.|...:::.:   :.:|:.|            
  Fly   313 GGNGLVNGANPNGLTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLL 377

  Fly   315 --------------------------EVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKREL 353
                                      :||..|.||:|:..:|.::.:|.|.|:|.:...:.|..:
  Fly   378 AYQATKINGVNVYAFTVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFV 442

  Fly   354 LFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLRAK 397
            .....:.|:...|....:..:||:.|..|:....:.|.:|::.|
  Fly   443 QIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 72/438 (16%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 67/427 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.