DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or83a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:423 Identity:81/423 - (19%)
Similarity:143/423 - (33%) Gaps:117/423 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LYVVY-----SITVN-LVVTVLFPLSLLARLLFTTNMAGLCENLTITITDIVANLKFANVYMVRK 95
            :|:.|     ...|| |:.|:::..::..:|.|.....||...:...|.|               
  Fly    75 IYINYGQGDLDFFVNCLIQTIIYLWTIAMKLYFRRFRPGLLNTILSNIND--------------- 124

  Fly    96 QLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFASIFVFGTTLSCVRVVVRPDREL 160
             .:|.||.:..            ....:.....:::...:|:......||.......:...||.|
  Fly   125 -EYETRSAVGF------------SFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRSL 176

  Fly   161 LYPAWFGVDWMHSTRNYVLINIYQLFGLI-----VQAIQNCASDSYPPAFLC-LLTGHMRALELR 219
            ....|:..|       |....:|::..|:     :|...:.||.|.....|| |::|....|...
  Fly   177 PLACWYPFD-------YTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCS 234

  Fly   220 VRRI--------GCRTEKSNK------------GQ-TYEAWREEVYQEL---------------- 247
            ::.:        |....:.|:            || .|....|...|||                
  Fly   235 LKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLS 299

  Fly   248 -IECIRDLARVHR-----LREI-----------IQRVLSVPCMAQFVCSAAVQCTVAMHFLYVAD 295
             :.||:.    ||     |::|           |..|..:.|:..||   :.:.|.|..|:    
  Fly   300 FVRCIQH----HRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFV---STKSTAANSFM---- 353

  Fly   296 DHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLART 360
                 .|:....:...|..|:|:||||.|.:...|:...:|.:...|...|...:.:.:|.:..:
  Fly   354 -----RMVSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNS 413

  Fly   361 QRPSLIYAGNYIALSLETFEQVMRFTYSVFTLL 393
            :|...:.||....|:::.|...:...:|..|||
  Fly   414 RRQFQLTAGKISNLNVDRFRGTITTAFSFLTLL 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 69/380 (18%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 61/307 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E3WB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.