DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or67c

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524018.2 Gene:Or67c / 39189 FlyBaseID:FBgn0036078 Length:404 Species:Drosophila melanogaster


Alignment Length:414 Identity:91/414 - (21%)
Similarity:162/414 - (39%) Gaps:108/414 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VSSLLYVVY----SITVNLVVTVLFPLSLLARLLFTTNMAGLCENLTITIT-------DIVANLK 86
            :.|||:.:|    .|..||:|        :..|:|..|.....|.:.:.|.       .:||:.|
  Fly    39 LKSLLFKIYLYAGFINFNLLV--------IGELVFFYNSIQDFETIRLAIAVAPCIGFSLVADFK 95

  Fly    87 FANVYMVRKQLHEIRSLLRLMDARARLVGDPEEI--SALRKEVNIA----QGTFRTFASIFVF-- 143
            .|  .|:|.:    ::|:.|:|       |.|.:  ..|.|::...    :.|.:...:||.|  
  Fly    96 QA--AMIRGK----KTLIMLLD-------DLENMHPKTLAKQMEYKLPDFEKTMKRVINIFTFLC 147

  Fly   144 ---GTTLS---CVRVVVR--------PDRELLYPAWFGVDWMHSTRNYVLINIYQLF------GL 188
               .||.|   .::..|:        .||...:..||..|   :|||.:   ||.:.      |.
  Fly   148 LAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLIWFPFD---ATRNNL---IYWIMYWDIAHGA 206

  Fly   189 IVQAIQNCASDSYPPAFLCL----------LTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEV 243
            .:..|          ||||.          :..|...:.:|:....|.:.:.             
  Fly   207 YLAGI----------AFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNED------------- 248

  Fly   244 YQELIECIRDLARVH----RLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMII 304
             :|.||.:..:.|.|    :|.|.:..:.|...:..|:.::...|.:|    :...:.....:||
  Fly   249 -KENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIA----FQVTESTVEVIII 308

  Fly   305 SIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAG 369
            ..:|.....::||::||:||.:...|..:.||.|:..|.:....:...|...:.|:|:|:.|...
  Fly   309 YCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPP 373

  Fly   370 NYIALSLETFEQVMRFTYSVFTLL 393
            .:..:||.|:.:|:..:|..|.||
  Fly   374 TFPPISLVTYMKVISMSYQFFALL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 77/369 (21%)
Or67cNP_524018.2 7tm_6 86..391 CDD:251636 74/351 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465896
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.