DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or67a

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:239 Identity:54/239 - (22%)
Similarity:104/239 - (43%) Gaps:35/239 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 DRELLYPAWFGVDWMHSTRNYV-----LINIYQLFGLIVQAIQNCASDSYPPAFLCLLTGHMRAL 216
            |..|.||::|    ..|:..|.     :.....:|.:::|.|.                 |...|
  Fly   191 DSWLFYPSYF----HQSSAGYTATCGSIAGDLMIFAVVLQVIM-----------------HYERL 234

  Fly   217 ELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVPCMAQFVCSAA 281
            ...:|....:...:..|.     :|:: ::|...:.:...:.||.:::..|..:|.:..|:.||.
  Fly   235 AKVLREFKIQAHNAPNGA-----KEDI-RKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASAL 293

  Fly   282 VQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQL 346
            :.|.|.:. |.:|...::...  .::|..:|.|||:::|.|..|:...||.:..|.||.:|:...
  Fly   294 LVCLVGVQ-LTIALSPEYFCK--QMLFLISVLLEVYLLCSFSQRLIDASENVGHAAYDMDWLGSD 355

  Fly   347 PKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVF 390
            .:||:.|:|...|:|:|..:.|...:.||:.|....:..:|..|
  Fly   356 KRFKKILIFISMRSQKPVCLKATVVLDLSMPTMSIFLGMSYKFF 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 52/234 (22%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 52/234 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.