DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or2a and Or59c

DIOPT Version :9

Sequence 1:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:397 Identity:87/397 - (21%)
Similarity:165/397 - (41%) Gaps:29/397 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DFKLNTHSAVYYHWRVWELTGLMRPPG-VSSLLYVVYSITVNLVVTVLFPLSLLARLL-----FT 64
            |.::::..|..|::|:....|...|.| :...:|.::::|...:..|..||.|....:     ||
  Fly    15 DQEVSSLDASDYYYRIAFFLGWTPPKGALLRWIYSLWTLTTMWLGIVYLPLGLSLTYVKHFDRFT 79

  Fly    65 TNMAGLCENLTITITDI--VAN-LKFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKE 126
            ..     |.||....||  :.| :|....|....:...:..|:..:|.|............:...
  Fly    80 PT-----EFLTSLQVDINCIGNVIKSCVTYSQMWRFRRMNELISSLDKRCVTTTQRRIFHKMVAR 139

  Fly   127 VNIAQGTFRTFASIFVFGTTLSCVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQ 191
            ||:....|.:....|.|.|..:.|.....| .:|..|.   |||........:.:|.:...:.:.
  Fly   140 VNLIVILFLSTYLGFCFLTLFTSVFAGKAP-WQLYNPL---VDWRKGHWQLWIASILEYCVVSIG 200

  Fly   192 AIQNCASDSYPPAFLCLLTGHMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLAR 256
            .:|...||:|...|:.|...|:..|..|:         :|..|..:....|.|::::.||:|...
  Fly   201 TMQELMSDTYAIVFISLFRCHLAILRDRI---------ANLRQDPKLSEMEHYEQMVACIQDHRT 256

  Fly   257 VHRLREIIQRVLSVPCMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICY 321
            :.:..:||:.:||:...|||:.........|:..|:.  .:....::.::.|..|:..|.|..|.
  Fly   257 IIQCSQIIRPILSITIFAQFMLVGIDLGLAAISILFF--PNTIWTIMANVSFIVAICTESFPCCM 319

  Fly   322 FGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFT 386
            ..:.:...|..:.:|.:..|||.....:|..:|:.|.|.|:|....||:...:|:::...|.:|.
  Fly   320 LCEHLIEDSVHVSNALFHSNWITADRSYKSAVLYFLHRAQQPIQFTAGSIFPISVQSNIAVAKFA 384

  Fly   387 YSVFTLL 393
            :::.|::
  Fly   385 FTIITIV 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 71/323 (22%)
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 72/325 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.